PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_002798-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 433aa    MW: 49357.5 Da    PI: 7.3518
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_002798-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.1e-13202240948
                      HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +  lv++vkq+G++ W+ Ia+ ++ gR +kqc++rw+++l
    NNU_002798-RA 202 HRVLVELVKQYGMRKWSYIAQQLN-GRIGKQCRERWYNHL 240
                      6679********************.*************97 PP

2Myb_DNA-binding43.66.9e-14246280945
                      HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      d +lv+a+++lG++ W+ Ia++++ gRt++++k++w+
    NNU_002798-RA 246 DRILVQAHAELGNK-WAEIAKRLP-GRTENSIKNHWN 280
                      679***********.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.969178244IPR017930Myb domain
SMARTSM007174.9E-7182242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-19182243IPR009057Homeodomain-like
SuperFamilySSF466892.92E-24183283IPR009057Homeodomain-like
CDDcd001677.43E-12186240No hitNo description
PfamPF002492.3E-10204240IPR001005SANT/Myb domain
PROSITE profilePS5129414.95246287IPR017930Myb domain
PfamPF002493.6E-12246280IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-15246281IPR009057Homeodomain-like
SMARTSM007174.6E-7246285IPR001005SANT/Myb domain
CDDcd001675.92E-10246283No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MELGLFYRAG LAYQPMFSLG NCSNPNSGDG FSQEASSLKR YSQDLHHAHH FPGDGSSSIM  60
TYGFPIPRFD QVGTTASGYS KNLRVFESKP FVENGGDVVM ESFQSKSLLN YDQRTPGSYM  120
AEKDISHQPQ NLGETESTNL GLPYEAPCIV PADNGLHRKV GLNKRRVSVR KTGKLDERNK  180
VVKAQWTNEE DRSIDHANVY MHRVLVELVK QYGMRKWSYI AQQLNGRIGK QCRERWYNHL  240
RPDIKDRILV QAHAELGNKW AEIAKRLPGR TENSIKNHWN ATKRKQLSKR QYCRGSKYAK  300
SSSLLQDYIK SLAAASSAGT DYIQQDEYLT HSNMPSIQTM ITSSPTDEQE TKDYCAGDRL  360
VPAAFDLDFD MPDYFSFDAK LLDDRCSIES LFEEMLCVSV VDEKSWKMER PLPLDCEAKR  420
EMDLVEMITQ GNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-361812872105C-Myb DNA-Binding Domain
1msf_C4e-361812872105C-Myb DNA-Binding Domain
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010249414.10.0PREDICTED: transcription factor MYB98-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-61myb domain protein 98